SDF1 – Stromal Cell-Derived Factor 1α (CXCL12) tested in migration

Price range: € 120 through € 950

Add to cart to request a document with our quotation
SKU: HM-17x Categories: , Tags: , , ,


SDF1 – Stromal Cell-Derived Factor 1α ( CXCL12) tested in migration, LPS-Free

Recombinant Stromal Cell-Derived Factor 1α (SDF-1α) is a 8 kDa chemokine protein expressed in many tissues and cell types.
The protein is almost identical (92% homology) in human, mouse and rat.

The chemokine SDF-1α binds to the chemokine receptor CXCR4 and plays an essential and unique role in homeostatic regulation of leukocyte traffic, hematopoiesis, organogenesis, cell differentiation and tissue regeneration (Murphy, 2002).

SDF-1α forms an heterocomplex with the alarmin HMGB1 (High Mobility Group 1) to promote the recruitment of cells via CXCR4 receptor.

It has the sequence:

[“MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK”]

Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDA
Purity: The purified protein is >95% homogeneous (electrophoresis). It contains no nucleic acids.
Endotoxin Level: The purified protein is free from LPS (Pierce™ Chromogenic Endotoxin Quant Kit, <0.1 EU/mL). The product contains <0.006% v/v of Triton X-114 due to LPS removal procedure. The remaining traces of Triton X-114 can be removed upon request.
Activity: Measured by its ability to induce migration. Maximal activity in the cell migration assay is obtained at 1 nM.
Buffer & Reconstitution: the lyophilized protein once reconstituted with distilled water will be dissolved in a solution of DPBS without Ca and Mg.
Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.

This product is intended for research only, and cannot be used on humans.

Publications:

16th June 2023
HMGB1●CXCL12 : the first fuzzy chemokines heterocomplex reported so far

HMGBiotech Srl participated in a recent study in which, through an integrative structural approach,
molecular details of HMGB1●CXCL12 heterocomplex formation were unveiled.
This dynamic complex is formed equimolarly, contrary to previous assumptions.
Structured and unstructured HMGB1 regions interact with the dimerization surface of CXCL12. This work elucidated how the acidic IDR is involved in HMGB1●CXCL12 complex formation.The findings suggest that interfering with the interactions in the HMGB1●CXCL12 complex could potentially inhibit its detrimental effects in inflammatory conditions. Read the full article about the study…

Mantonico et al. The acidic intrinsically disordered region of the inflammatory mediator HMGB1 mediates fuzzy interactions with chemokine CXCL12. bioRxiv 2023.

References:

Schiraldi et al (2012) HMGB1 promotes recruitment of inflammatory cells to damaged tissues by forming a complex with CXCL12 and signaling via CXCR4. J Exp Med. 2012: 551–563.

Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) Datasheet

Size

15 µg, 50 µg, 100 µg, 250 µg

Shopping Cart
SDF1 - Stromal Cell-Derived Factor 1α (CXCL12) tested in migrationSDF1 – Stromal Cell-Derived Factor 1α (CXCL12) tested in migration
Price range: € 120 through € 950Select options