SDF1 (CXCL12) labelled 15N for Mass Spectometry and NMR

Price range: € 320 through € 1800

Add to cart to request a document with our quotation


SDF1 (CXCL12) labelled 15N for Mass Spectometry and NMR, LPS-Free

SDF-1α for Mass Spectrometry is the 8 kDa protein uniformly labelled with isotope 15N.
This protein is suitable for Mass Spectrometry and NMR studies.
This product corresponds to the human sequence and is produced in E.coli using a media in which the only source of nitrogen come from 15NH4Cl.
SDF-1α we provide is the natural protein, with no tags or additional amino acids.

It has the sequence:

[“MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK”]

Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDA
Purity: The purified protein is >95% homogeneous (electrophoresis and mass spectrometry). It contains no nucleic acids.
Endotoxin Level: The purified protein is free from LPS (Pierce™ Chromogenic Endotoxin Quant Kit, <0.1 EU/mL). The product contains <0.006% v/v of Triton X-114 due to LPS removal procedure. The remaining traces of Triton X-114 can be removed upon request.
Buffer: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) is lyophilized from DPBS without Ca and Mg.
Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.

This product is intended for research only, and cannot be used on humans.

Publications:

16th June 2023
HMGB1●CXCL12 : the first fuzzy chemokines heterocomplex reported so far

HMGBiotech Srl participated in a recent study in which, through an integrative structural approach,
molecular details of HMGB1●CXCL12 heterocomplex formation were unveiled.
This dynamic complex is formed equimolarly, contrary to previous assumptions.
Structured and unstructured HMGB1 regions interact with the dimerization surface of CXCL12. This work elucidated how the acidic IDR is involved in HMGB1●CXCL12 complex formation.The findings suggest that interfering with the interactions in the HMGB1●CXCL12 complex could potentially inhibit its detrimental effects in inflammatory conditions. Read the full article about the study…

Mantonico et al. The acidic intrinsically disordered region of the inflammatory mediator HMGB1 mediates fuzzy interactions with chemokine CXCL12. bioRxiv 2023.

 

SDF-1α labelled 15N for Mass Spectometry and NMR Datasheet

 

Size

5 µg, 50 µg

Shopping Cart
SDF1 (CXCL12) labelled 15N for Mass Spectometry and NMRSDF1 (CXCL12) labelled 15N for Mass Spectometry and NMR
Price range: € 320 through € 1800Select options